Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MLTHTGPICVGLMSDFLSIGYPHCLFFLELLQNANFRNAMAHPTSKELAHRQQYFFWKNYRNNRVKHILPRPPPEPTPAPSQAPATLPLPASVPTPVAPPVPAPTSSMPPVVAGGASAMSPMQFVGTPSTNMPKNGMRNAMGNRKRKMG |
Length | 149 |
Position | Middle |
Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.304 |
Instability index | 64.87 |
Isoelectric point | 10.50 |
Molecular weight | 16227.80 |
Publications | PubMed=19189423 PubMed=29161754 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP09232 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.61| 16| 19| 70| 88| 1 --------------------------------------------------------------------------- 70- 88 (30.99/12.98) PRPPPEPTPAP.SQAPatlP 94- 110 (30.63/ 8.35) PTPVAPPVPAPtSSMP...P --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MRNAMGNRKRKM 2) QQYFFWKNYRNNRVKHILPRPPPEP | 137 52 | 148 76 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab