<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09232
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MLTHTGPICVGLMSDFLSIGYPHCLFFLELLQNANFRNAMAHPTSKELAHRQQYFFWKNYRNNRVKHILPRPPPEPTPAPSQAPATLPLPASVPTPVAPPVPAPTSSMPPVVAGGASAMSPMQFVGTPSTNMPKNGMRNAMGNRKRKMG |
| Length | 149 |
| Position | Middle |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.304 |
| Instability index | 64.87 |
| Isoelectric point | 10.50 |
| Molecular weight | 16227.80 |
| Publications | PubMed=19189423
PubMed=29161754
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09232
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.61| 16| 19| 70| 88| 1
---------------------------------------------------------------------------
70- 88 (30.99/12.98) PRPPPEPTPAP.SQAPatlP
94- 110 (30.63/ 8.35) PTPVAPPVPAPtSSMP...P
---------------------------------------------------------------------------
|