<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09217
| Description |
Uncharacterized protein |
| Sequence | MVSEAARRRQEMAVEGQRHLEETMAAAFQILVSLNDELCNAGLWSSAVSATAAAASSQHGHSATPPPPPPPHSADSNAADAGDVPGLGGSFDEARHRYMSAVAALRASISSLSSCAQDTGSTESEADHAEIERLEEHASALRKEIESKNKQVKLLMDQLRDLITDVAMWQSPCSV |
| Length | 175 |
| Position | Head |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.375 |
| Instability index | 70.17 |
| Isoelectric point | 4.97 |
| Molecular weight | 18591.39 |
| Publications | PubMed=19189423
PubMed=29161754
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09217
No repeats found
|