<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09211
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGNGPRELTGAVDLISHYKLLPHHDFFCKKPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYMRDKPAYIQPFDMETLGQAFQLRETAPVDLPSTEKGIPTISGKPKSESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHDSDSKKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDETGNGLS |
| Length | 217 |
| Position | Head |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.635 |
| Instability index | 32.82 |
| Isoelectric point | 9.32 |
| Molecular weight | 25015.74 |
| Publications | PubMed=19189423
PubMed=29161754
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP09211
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.54| 18| 21| 133| 152| 1
---------------------------------------------------------------------------
134- 151 (35.98/ 8.33) DKDRDKDKEHKKHKHRHK
156- 173 (32.55/ 8.69) DKDKDKDKDKKKDKSGHH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.88| 13| 16| 174| 186| 2
---------------------------------------------------------------------------
174- 186 (23.92/ 9.73) DS.DSKKHHEKKRK
192- 205 (19.96/ 6.86) DSaDVHKHKKSKHK
---------------------------------------------------------------------------
|