<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09203
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MDQLSGDKKEQKNGTPLSVDEIEIEILPTIYAIIRSVEKDPIDKQRESQDCSLKSSKKVLELQKRLESVRNQIRQLPIDLNKEEQLQRLETLRNQLLLKQKLLTKYKNIQF |
| Length | 111 |
| Position | Middle |
| Organism | Phlebotomus papatasi (Sandfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae>
Phlebotomus> Phlebotomus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.831 |
| Instability index | 64.17 |
| Isoelectric point | 9.01 |
| Molecular weight | 13073.97 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09203
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.85| 12| 21| 61| 73| 1
---------------------------------------------------------------------------
61- 73 (17.13/15.56) ELQkRLESVRNQI
85- 96 (21.71/14.22) QLQ.RLETLRNQL
---------------------------------------------------------------------------
|