<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09191
| Description |
Uncharacterized protein |
| Sequence | MVGNGKGKKPNCQRQKCFLQYRLAFNEFPNATAHAMYVTCAELLNLPLAPKIVADNVIDVVLKVYVLISSRETHNYINAISIVLAELPDTYWSVVYEGLQEVLNLPRMLRWTYRFNVFELLNFRTVRQTMVDKTYAAILAVTHSVFHHMGCFKLVTITKYIKEKLKPCVHTESQLVFLYHVFGPFLQHIEQEKPNAVTGIAILLYEMLEVVDKHDGPTPLEYMDPICDLLYHIKYIHVGNIIKNESEAIIKRLRPVLQKCLRFVTYLNIKDKHNEKPNEIQHTPATNVNNITSCNQFPVTQSFPI |
| Length | 305 |
| Position | Tail |
| Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.024 |
| Instability index | 34.94 |
| Isoelectric point | 8.65 |
| Molecular weight | 35232.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09191
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.41| 24| 25| 164| 188| 1
---------------------------------------------------------------------------
164- 188 (41.33/26.45) KLKPCVHTESQlVFLYHVFGPFLQH
191- 214 (37.07/19.54) QEKPNAVTGIA.ILLYEMLEVVDKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.09| 18| 107| 137| 163| 2
---------------------------------------------------------------------------
117- 136 (25.37/26.22) VFELLN.FRTVRQTMVDKtyA
145- 163 (27.72/17.22) VFHHMGcFKLVTITKYIK..E
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.03| 21| 57| 27| 47| 3
---------------------------------------------------------------------------
27- 47 (38.98/30.41) EFPNATAHAMYVTCAELLNLP
86- 106 (39.05/30.48) ELPDTYWSVVYEGLQEVLNLP
---------------------------------------------------------------------------
|