<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09186
Description |
Uncharacterized protein |
Sequence | MHIILALYDKLSKLELRKRRDQLMWILLPFISGSIQKNSVSNFLPMFKLFDLLHPEQEPLKLPDCNNTSSLRQPFQQMAPICIWIHLMKKVRAENMNISRPLPTALKNHHEYAFLLYFYTCNYITLQFITFHIFLSFLQHLVMSNTIMSMNLGNDFRNI |
Length | 159 |
Position | Tail |
Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.046 |
Instability index | 63.73 |
Isoelectric point | 9.40 |
Molecular weight | 18903.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09186
No repeats found
|