<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09180
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAKMYGKGGKTAIESEEQQKLRWQVELEFVQCLANPNYLNFLAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMFNSVNNTQMNAAATCGTEINEAQQPQMAAQQPGSNSAAGVNIQNGNTGVNTQQAQLVGSQQQSQQMNGTNSVNPLMQKMQ |
Length | 200 |
Position | Middle |
Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.661 |
Instability index | 49.84 |
Isoelectric point | 8.53 |
Molecular weight | 23188.07 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09180
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.94| 19| 26| 143| 161| 1
---------------------------------------------------------------------------
143- 161 (34.20/18.09) QQPQMAAQQPGSNSAAGVN
172- 190 (33.74/17.76) QQAQLVGSQQQSQQMNGTN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.73| 20| 22| 70| 91| 2
---------------------------------------------------------------------------
72- 91 (39.81/29.49) LMYPMCLYFLD...LLQYEHFRR
93- 115 (34.92/18.22) IVNSQCCKFIDdqaILQWQHYTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.33| 12| 19| 38| 49| 4
---------------------------------------------------------------------------
38- 49 (22.27/12.98) YLNFLAQRGYFK
59- 70 (24.06/14.53) YLQYWKEPEYAK
---------------------------------------------------------------------------
|