<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09179

Description Mediator complex subunit 30
SequenceMSGQYPGGYNNAISGHRGQFNAQQQQQQQQMMNQLQMGGPGGMMSMGYNQGGMMQQQQQVSPMQGMSGPTSGGIGVMNPGMQSPSHVQQQLMQQQQIQMQQQQQQMGPQMGMSPQPHKEINIVALSRVGQETVQDITSRFQEIFTALKVIQPTANRDNSTVKKVQEHFRTIRLLFKRMRLIYERCNDGCLGYPQGMEYTTVESLIPFKDEPEHRLEATQCEEYRKALQENQELIDTVKLKNRQLREIIDRTRIIVWEINTMLSMRKS
Length267
PositionHead
OrganismGlossina morsitans morsitans (Savannah tsetse fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina.
Aromaticity0.05
Grand average of hydropathy-0.784
Instability index53.01
Isoelectric point8.99
Molecular weight30585.64
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP09179
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.30|      26|      30|      27|      56|       1
---------------------------------------------------------------------------
   27-   56 (53.07/25.26)	QQQQMmnqlQ.MGGP..GG.......MMSMGYNQGGMMQQ
   59-   94 (36.23/10.84)	QVSPM....QgMSGPtsGGigvmnpgMQSPSHVQQQLMQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.99|      24|      29|     132|     155|       2
---------------------------------------------------------------------------
  132-  155 (40.51/26.34)	TVQDITSRFQEI...FTALKVIQPTAN
  160-  186 (36.48/23.14)	TVKKVQEHFRTIrllFKRMRLIYERCN
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP09179 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) GQYPGGYNNAISGHRGQFNAQQQQQQQQMMNQLQMGGPGGMMSMGYNQGGMMQQQQQVSPMQGMSGPTSGGIGVMNPGMQSPSHVQQQLMQQQQIQMQQQQQQMGPQMGMSPQPHKEINIVALS
3
126

Molecular Recognition Features

MoRF SequenceStartStop
NANANA