<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09175
| Description |
Uncharacterized protein |
| Sequence | MEKLNFTLGAVRNLRSSVRQCFEKLADGSPEQNEENNAKFLLEFQENFSDINHQIKELEGIINSLQVPPAPYYLGNTTYLAQETTQDRQALYSQLVNSYKWIDKVHDHSLLAYNNLNVNSLRRSYIYNSQKRGRVQCSTCNTPDPDEISHPNTTYKVCRPFGSSAVVVITISHVLKAALVCKGVLIEWVSVKGFDEHIDFDDLFAESRYAVFRKVQENTQAAMLHFFSPTLPDLAIKSYMAWFHSYSRLFVEPCKRCGKFLANGLPPTWRDLRTLEPYHEECKN |
| Length | 284 |
| Position | Tail |
| Organism | Glossina morsitans morsitans (Savannah tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.430 |
| Instability index | 40.58 |
| Isoelectric point | 6.75 |
| Molecular weight | 32714.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09175
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.37| 17| 21| 86| 102| 1
---------------------------------------------------------------------------
86- 102 (32.30/23.24) QDRQAL.YSQL.VNSYK..WI
106- 126 (18.07/10.01) HDHSLLaYNNLnVNSLRrsYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.10| 12| 22| 148| 159| 2
---------------------------------------------------------------------------
148- 159 (23.62/13.15) ISHPNTTYKVCR
171- 182 (20.48/10.75) ISHVLKAALVCK
---------------------------------------------------------------------------
|