<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09151
Description |
Uncharacterized protein |
Sequence | MASSSNGNGNLLDEFEESFQACLHALAKEEPSTEIDKEALKLEVDQTTMKFIHLARQMEAFFLQKRFLLSALKPELVLKEENLDLRYEIQRKDELIRKHYEKIDQWKSLLMDQQPITQQGSAGMQGSNDMRGLQGTGTAGPMMGGGTAGGVTGGPGGAGVMSQGPPGAMGLPGMSGPMQ |
Length | 179 |
Position | Head |
Organism | Phlebotomus papatasi (Sandfly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae>
Phlebotomus> Phlebotomus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.464 |
Instability index | 39.82 |
Isoelectric point | 5.11 |
Molecular weight | 19343.85 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.13| 21| 35| 120| 142| 1
---------------------------------------------------------------------------
120- 142 (37.39/21.33) GSAGM..QGSNDMRGLqgTGTAGPM
156- 178 (39.74/17.50) GGAGVmsQGPPGAMGL..PGMSGPM
---------------------------------------------------------------------------
|