<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09148

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMQQPPMQGMQSMPNQRPGGTGPGPMPNQMAGGGQMGMGMGGMNQGGGGGAPGPGQMSMGPGMNAGGGPGGGPGGPGGPGGPMQMNPGGIQGQPGPGQMGQMGGMGQMSMNPVMSQGQMGNSMTPVSMGQPMNPGGMGGMGGPMGPGMMGPMTTAGNVVIQQQPQQQGGMNPAITTQGGGMGPNAGQMNPGQLVGMQQMARKGPEMMMTQQGGVFPGVRSVTPNQFLRQSPSPSVPSPASMGQPHQQGMVPSPAMVPSPSPQSMAQGPPRSMGGVITQSPSSTLNTPGQASVYSPLNPQEDLLYREKYRQLTKYIEPLKRMIARMVNDKNNGNLQKMNKLLEILCNPNQRIPLETLLKCEKALEKMDFKTNVLGPVSAQGANAKEHPINNPLLEAVSVNLQNPIGNHTLQRTFRPCLEALFGPDIKNLPPPAKQARLSTPEEAPASTGPEIPHILQGEIARLDQKFKINLDSSAQIDDYPSTAPTCNLMEQEYNATPFLVAVQKALTARISKLPRQFSLSHLLDTWEMSVRQACAPVVVNPSQTTVLLGI
Length549
PositionTail
OrganismPhlebotomus papatasi (Sandfly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae> Phlebotomus> Phlebotomus.
Aromaticity0.03
Grand average of hydropathy-0.470
Instability index56.18
Isoelectric point9.27
Molecular weight57368.54
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09148
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.19|      17|      19|      36|      54|       1
---------------------------------------------------------------------------
   36-   54 (36.28/11.05)	GMGMGGMnqGGGGGAPGPG
  130-  146 (36.91/ 7.43)	PMNPGGM..GGMGGPMGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     162.64|      24|      24|      68|      91|       2
---------------------------------------------------------------------------
   59-   76 (40.25/ 9.53)	GPG....MNA.....GG..G.PGGGPGGPG
   77-  101 (49.33/13.70)	GPGGPMQMNP.....GGIQGqPGPGQMGQM
  102-  125 (36.84/ 7.96)	GGMGQMSMNP.....VMSQG.QMGNSMTPV
  165-  190 (36.21/ 7.67)	QQGG...MNPaittqGGGMG.PNAGQMNPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     211.06|      51|      54|     337|     390|       4
---------------------------------------------------------------------------
  295-  342 (36.50/15.18)	L.NPQ.....EDLLY....REK......YRqlTKYIE.......PLKrmiARM..VNDKN.....NGnlqkmNKlLEI
  343-  394 (77.93/38.13)	LCNPNqrIPLETLLK....CEKALEKMDFK..TNVLG.......PVS...AQG..ANAKEHPIN.NP.......lLEA
  399-  449 (58.21/23.33)	LQNP...IGNHTLQRtfrpCLEALFGPDIK...N.LP.......PPA...KQArlSTPEEAPAS.TG.....PE....
  450-  496 (38.43/12.68)	.......IP..HILQ....GEIARLDQKFK..INLDSsaqiddyPST...APT..CNLMEQEYNaTP...........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.72|      19|     183|       8|      31|       6
---------------------------------------------------------------------------
    8-   31 (36.39/21.92)	GMQSMPNQrpggtGPGPMPNQMAG
  194-  212 (34.33/11.44)	GMQQMARK.....GPEMMMTQQGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.11|      15|      18|     255|     269|       7
---------------------------------------------------------------------------
  255-  269 (30.22/11.31)	VPSPSPQSMAQGPPR
  274-  288 (25.89/ 8.72)	VITQSPSSTLNTPGQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09148 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQQPPMQGMQSMPNQRPGGTGPGPMPNQMAGGGQMGMGMGGMNQGGGGGAPGPGQMSMGPGMNAGGGPGGGPGGPGGPGGPMQMNPGGIQGQPGPGQMGQMGGMGQMSMNPVMSQGQMGNSMTPVSMGQPMNPGGMGGMGGPMGPGMMGPMTTAGNVVIQQQPQQQGGMNPAITTQGGGMGPNAGQMNPGQLVGMQQMARKGPEMMMTQQGGVFPGVRSVTPNQFLRQSPSPSVPSPASMGQPHQQGMVPSPAMVPSPSPQSMAQGPPRSMGGVITQSPSSTLNTPGQASVYSPLNPQ
1
298










Molecular Recognition Features






MoRF SequenceStartStop




NANANA