<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09148
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MQQPPMQGMQSMPNQRPGGTGPGPMPNQMAGGGQMGMGMGGMNQGGGGGAPGPGQMSMGPGMNAGGGPGGGPGGPGGPGGPMQMNPGGIQGQPGPGQMGQMGGMGQMSMNPVMSQGQMGNSMTPVSMGQPMNPGGMGGMGGPMGPGMMGPMTTAGNVVIQQQPQQQGGMNPAITTQGGGMGPNAGQMNPGQLVGMQQMARKGPEMMMTQQGGVFPGVRSVTPNQFLRQSPSPSVPSPASMGQPHQQGMVPSPAMVPSPSPQSMAQGPPRSMGGVITQSPSSTLNTPGQASVYSPLNPQEDLLYREKYRQLTKYIEPLKRMIARMVNDKNNGNLQKMNKLLEILCNPNQRIPLETLLKCEKALEKMDFKTNVLGPVSAQGANAKEHPINNPLLEAVSVNLQNPIGNHTLQRTFRPCLEALFGPDIKNLPPPAKQARLSTPEEAPASTGPEIPHILQGEIARLDQKFKINLDSSAQIDDYPSTAPTCNLMEQEYNATPFLVAVQKALTARISKLPRQFSLSHLLDTWEMSVRQACAPVVVNPSQTTVLLGI |
| Length | 549 |
| Position | Tail |
| Organism | Phlebotomus papatasi (Sandfly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae>
Phlebotomus> Phlebotomus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.470 |
| Instability index | 56.18 |
| Isoelectric point | 9.27 |
| Molecular weight | 57368.54 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09148
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.19| 17| 19| 36| 54| 1
---------------------------------------------------------------------------
36- 54 (36.28/11.05) GMGMGGMnqGGGGGAPGPG
130- 146 (36.91/ 7.43) PMNPGGM..GGMGGPMGPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 162.64| 24| 24| 68| 91| 2
---------------------------------------------------------------------------
59- 76 (40.25/ 9.53) GPG....MNA.....GG..G.PGGGPGGPG
77- 101 (49.33/13.70) GPGGPMQMNP.....GGIQGqPGPGQMGQM
102- 125 (36.84/ 7.96) GGMGQMSMNP.....VMSQG.QMGNSMTPV
165- 190 (36.21/ 7.67) QQGG...MNPaittqGGGMG.PNAGQMNPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 211.06| 51| 54| 337| 390| 4
---------------------------------------------------------------------------
295- 342 (36.50/15.18) L.NPQ.....EDLLY....REK......YRqlTKYIE.......PLKrmiARM..VNDKN.....NGnlqkmNKlLEI
343- 394 (77.93/38.13) LCNPNqrIPLETLLK....CEKALEKMDFK..TNVLG.......PVS...AQG..ANAKEHPIN.NP.......lLEA
399- 449 (58.21/23.33) LQNP...IGNHTLQRtfrpCLEALFGPDIK...N.LP.......PPA...KQArlSTPEEAPAS.TG.....PE....
450- 496 (38.43/12.68) .......IP..HILQ....GEIARLDQKFK..INLDSsaqiddyPST...APT..CNLMEQEYNaTP...........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.72| 19| 183| 8| 31| 6
---------------------------------------------------------------------------
8- 31 (36.39/21.92) GMQSMPNQrpggtGPGPMPNQMAG
194- 212 (34.33/11.44) GMQQMARK.....GPEMMMTQQGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.11| 15| 18| 255| 269| 7
---------------------------------------------------------------------------
255- 269 (30.22/11.31) VPSPSPQSMAQGPPR
274- 288 (25.89/ 8.72) VITQSPSSTLNTPGQ
---------------------------------------------------------------------------
|