<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09132
| Description |
Uncharacterized protein |
| Sequence | MGTQRNLPNSKEALLKSYNTRLKDDVKSMQENFEEILKLAKGENDSQLSKITQCEQDTYEMQVRAANIVRAGESLMKLVSDIKQYLILNDFHSVNEAITANSQLYRSTQSDCDKKLMGLRDDLAADLYDLEEEYYTSVYK |
| Length | 140 |
| Position | Head |
| Organism | Lutzomyia longipalpis (Sand fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae>
Lutzomyia> Lutzomyia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.707 |
| Instability index | 29.70 |
| Isoelectric point | 4.85 |
| Molecular weight | 16117.93 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09132
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.31| 20| 55| 45| 64| 1
---------------------------------------------------------------------------
45- 64 (36.16/27.40) DSQLSKITQCEQDTYEMQVR
101- 120 (36.15/27.39) NSQLYRSTQSDCDKKLMGLR
---------------------------------------------------------------------------
|