<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09126
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MFNYGNMMTDFRKVESSYSPKSSSPRGGRSQDSSGTLKTTISLGKNPSIVHSGPFYLMKEPPSECGVTGATNLMSYNNLEHSYSKYSGKKVKEQLSSFLPNLPGVIDGPGQQDGSSLRSVIDKPPIVGKELLSLTSVQLAGFRLHPGPLPEHYRYLNTAPAKKHKNKHKKHKHKDGVAPQESVVGFLRDAQDDHFAGGRTPSIVHSGPFYLMKEPPSECGVTGATNLMSYNNLEHSYSKYSGKKVKEQLSSFLPNLPGVIDGPGQQDGSSLRSVIDKPPIVGKELLSLTSVQLAGFRLHPGPLPEHYRYLNTAPAKKHKNKHKKHKHKDGVAPQESVVDATGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPGGSIPPQTQIF |
| Length | 392 |
| Position | Head |
| Organism | Lutzomyia longipalpis (Sand fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Psychodoidea> Psychodidae>
Lutzomyia> Lutzomyia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.937 |
| Instability index | 54.14 |
| Isoelectric point | 9.81 |
| Molecular weight | 43459.85 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09126
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 334.90| 52| 85| 48| 99| 1
---------------------------------------------------------------------------
48- 95 (88.56/39.84) ........................................SIVHSGPFYLMKEP.PSECGVTGATNLMSYNNLEHSYSKYSGKKVKEQL
96- 183 (78.89/34.83) SSFLpnlpgvidgpgqqdgsslrsvidkppivgkellsltSVQLAG.FRLHPGPlPEHYRYLNTAPAKKHKNKHKKHKHKDGVAPQESV
202- 249 (88.56/39.84) ........................................SIVHSGPFYLMKEP.PSECGVTGATNLMSYNNLEHSYSKYSGKKVKEQL
250- 337 (78.89/34.83) SSFLpnlpgvidgpgqqdgsslrsvidkppivgkellsltSVQLAG.FRLHPGPlPEHYRYLNTAPAKKHKNKHKKHKHKDGVAPQESV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 156.17| 36| 151| 100| 135| 2
---------------------------------------------------------------------------
100- 135 (78.08/48.02) PNLPGVIDGPGQQDGSSLRSVIDKPPIVGKELLSLT
254- 289 (78.08/48.02) PNLPGVIDGPGQQDGSSLRSVIDKPPIVGKELLSLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.03| 10| 18| 346| 356| 3
---------------------------------------------------------------------------
346- 356 (16.56/14.30) HEKKHKKQkRH
367- 376 (19.48/11.34) KEKKRKKQ.RH
---------------------------------------------------------------------------
|