<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09118
Description |
Uncharacterized protein |
Sequence | MRITVGLRRIFNRGLQPIIVLLLVLLLNWSSRIHVCRIFIYFTVSHEEFGVFSNSRLISICQSVIKNKLSYAYTQDFPYRTNHILECEFCLLENLDCCLMVYQPYRSLLQLVQDMGQEDQLLTFSWRIVNDSLHTDVCLLYPSYQIAIACLQITCVILQKDLMKQWFAELNIDLDKVQEIVRAIVNLFELWKDWKEKDEIQMVLAKIPKPKPAPQR |
Length | 216 |
Position | Kinase |
Organism | Glossina palpalis gambiensis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.174 |
Instability index | 50.01 |
Isoelectric point | 7.52 |
Molecular weight | 25503.83 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09118
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.93| 19| 23| 31| 52| 1
---------------------------------------------------------------------------
31- 49 (35.80/28.56) SR.IHVCRIFIYFTVSH...EEF
55- 77 (24.13/ 9.68) SRlISICQSVIKNKLSYaytQDF
---------------------------------------------------------------------------
|