<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09099
Description |
Uncharacterized protein |
Sequence | MSGQYPGGYNNAISGHRGQFNAQQQQQQQQQQMMNQLQMGGQHGGPGGMMSMGSMGYNQGGMMQQQQQGIGPGVMNPVGMQSPSHVQQQLMQQQQIQMQQQQQQMGPQMGMVNQPGLSPQQPHKEINIVALSRVGQETVQDITSRFQEIFTALKVIQPTANRDNSTVKKVQEHFRTIRLLFKRMRLIYERCNDGYPQGMEYTTVESLIPFKDEPEHRLGLEATQCEEYRKALQENQELIDTVKLKNRQLREIIDRTRIIVWEINTMLSMRKS |
Length | 272 |
Position | Head |
Organism | Glossina palpalis gambiensis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.827 |
Instability index | 50.06 |
Isoelectric point | 9.10 |
Molecular weight | 31166.19 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09099
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 152.20| 34| 38| 1| 35| 1
---------------------------------------------------------------------------
1- 35 (67.24/29.32) MSGQY..PG.....GYNNaIS.GHRGQFNAQQQQ...QQQQQQMMN
39- 71 (53.56/19.48) MGGQHggPG.....GM...MSmGSMG.YN.QGGM...MQQQQQGIG
72- 105 (31.40/ 8.34) .......PGvmnpvGMQS..P.SHVQQQLMQQQQiqmQQQQQQM..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.82| 19| 32| 181| 200| 2
---------------------------------------------------------------------------
181- 200 (32.72/27.06) FK.....RMRLIYERCNDgYPQGME
210- 233 (27.10/16.63) FKdepehRLGLEATQCEE.YRKALQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.11| 13| 20| 124| 138| 3
---------------------------------------------------------------------------
124- 138 (13.03/19.44) KEInIVALsRVGQET
147- 159 (23.08/17.08) QEI.FTAL.KVIQPT
---------------------------------------------------------------------------
|