Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMFNSVNNTQLNAAATCGTEINEAQQPQMAAQQPGSNSAVGVNIQNGNTGVNTQQAQLAGSQQQSQQMNGTNSVNLGGVGGPLMQKMQ |
Length | 134 |
Position | Middle |
Organism | Glossina pallidipes (Tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.558 |
Instability index | 49.28 |
Isoelectric point | 7.67 |
Molecular weight | 14901.62 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09086 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.11| 19| 26| 71| 89| 1 --------------------------------------------------------------------------- 71- 89 (34.81/15.81) QQPQMAAQQPGSNSAVGVN 100- 118 (34.30/15.50) QQAQLAGSQQQSQQMNGTN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.06| 15| 22| 5| 19| 2 --------------------------------------------------------------------------- 5- 19 (30.31/19.93) CLYFLD...LLQYEHFRR 26- 43 (27.75/17.81) CCKFIDdqaILQWQHYTR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GVGGPLMQKMQ 2) TGVNTQQAQL | 124 95 | 134 104 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab