<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09060
Description |
Uncharacterized protein |
Sequence | MEKLNFTLGAVRNLRSSVRQCFEKLADGSPEQNEENNAKFLLEFQENFSDINHQIKELEGIINSLQVPPAPYYLGNTTYLAQETTQDRQALYSQLVNSYKWIDKVSYYIADSFFMGIKLFCCFQVHDHSLLAYNNLNVNSLRRSYIYNSQKRGRVQCSTCNTPDPDHVLKAALVCKGVLIEWVSVKGFDEHIDFDDLFAESRYAVFRKVQENTQAAMLHFFSPTLPDLAIKSYMAWFHSYSRLFVEPCKRCGKFLANGLPPTWRDLRTLEPYHEECKN |
Length | 278 |
Position | Tail |
Organism | Glossina pallidipes (Tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.393 |
Instability index | 38.82 |
Isoelectric point | 6.45 |
Molecular weight | 32291.29 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09060
No repeats found
|