<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09053
Description |
Uncharacterized protein |
Sequence | MRITVGLRRIFNRGLQPIIVFLLVLLLNWSSRIHVCRIFIYFTVSHEEFGVISNSRLISTCQSVIKSKLSYAYTQDFPYRTNHILECEFSLENLDCCLIVYQPYRLLLQLVQDMGQEDQLLTFSWRIVNDSLRTDVCLLYPSYQIAIACLQIACVILQKYSMKQWFAELNVDLDKVQEIVRAIVNLFELWKDWKEKDEIQMLLAKIPKPKPAPQR |
Length | 215 |
Position | Kinase |
Organism | Glossina fuscipes fuscipes (Riverine tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.158 |
Instability index | 46.31 |
Isoelectric point | 8.39 |
Molecular weight | 25354.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09053
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.42| 10| 23| 31| 40| 2
---------------------------------------------------------------------------
31- 40 (19.55/11.12) SR.IHVCRIFI
55- 65 (13.87/ 6.26) SRlISTCQSVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.55| 15| 15| 113| 127| 3
---------------------------------------------------------------------------
113- 127 (28.65/18.72) DMGQED.QLLTFSWRI
130- 145 (23.91/14.59) DSLRTDvCLLYPSYQI
---------------------------------------------------------------------------
|