<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09052
| Description |
Uncharacterized protein |
| Sequence | MLEVILDHLSILYKFHDRSITYLYNTLRFYERILRDRPCLKKKLASSFAYVLLPVIFVCFLICRYVEKKLKPCVHTKSQLVFLCHVVGPFLQLIEQETPKPVAGVDILLNEMLEVVDKHHEPTPLEYMDPICDLLHHIKYI |
| Length | 141 |
| Position | Tail |
| Organism | Glossina fuscipes fuscipes (Riverine tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.249 |
| Instability index | 41.62 |
| Isoelectric point | 7.66 |
| Molecular weight | 16668.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09052
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 14| 33| 28| 43| 1
---------------------------------------------------------------------------
28- 43 (21.70/17.55) RFYERILrdRPCLKKK
64- 77 (26.39/14.52) RYVEKKL..KPCVHTK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 17| 20| 90| 106| 2
---------------------------------------------------------------------------
90- 106 (28.54/17.08) FLQLIE.QETPKPVAGVD
112- 129 (26.90/15.78) MLEVVDkHHEPTPLEYMD
---------------------------------------------------------------------------
|