<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09044
Description |
Uncharacterized protein |
Sequence | MELSPNAEAVDIKPTLTADGLIKTSPTAPPVTTANITAGNSGLTVARLDIEILPVIYDILRCVEKDPLDNSTKQRESQECSQKVRPNFEYSYYPAKMVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRAKDLAREKRLNEMSPERFKQFMQAFKTNVKQEIEGVKEEIKKKK |
Length | 179 |
Position | Middle |
Organism | Glossina fuscipes fuscipes (Riverine tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.522 |
Instability index | 59.02 |
Isoelectric point | 9.28 |
Molecular weight | 20527.62 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09044
No repeats found
No repeats found
|