<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09039
Description |
Uncharacterized protein |
Sequence | MTSSSNVNSNLMDEFEEAFQNCLLSLTKLEANTGSTKEEIEFEAQKTIDRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENHDLRIEIQRKEALLNKHYSRLEEWKACLSDIQQNPSSLNRPVVGPVIPGAMGEGMPGTSAQGAPMGVGAATGLVIPQRSGMLPNMVGQMAQMAGQSSQQHLQNHKILQAQQMQQQLRMMGKLPK |
Length | 206 |
Position | Head |
Organism | Glossina fuscipes fuscipes (Riverine tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.462 |
Instability index | 54.34 |
Isoelectric point | 6.43 |
Molecular weight | 22969.13 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09039
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.53| 21| 25| 126| 147| 1
---------------------------------------------------------------------------
126- 147 (37.10/23.09) GPVIPGAMGEgMPGTSAQGAPM
154- 174 (40.44/20.92) GLVIPQRSGM.LPNMVGQMAQM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.85| 11| 23| 88| 98| 2
---------------------------------------------------------------------------
88- 98 (17.44/12.09) EIQRKEALLNK
112- 122 (19.41/14.21) DIQQNPSSLNR
---------------------------------------------------------------------------
|