<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09032

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMTILYKVQSVCGCKEAVASVLEWNPTGELLLIGYKHGLAEIWGMKANCMNSWFLLYTVNLPCEEIINVKFFHNSKATYFNMQKKDLQNYSDKYERLDQRPTLAYFGCSPVEGCFLLTASGLMGVFTIPRLPMNAETTNSASPSELNIFTNSIGLSRCFITHCSISYCPTGRFNVAINNWSEPRISCFKIGVEREQDDTLNLKCGAMASIFLQRADNENKEISVVHWRTVNCEEVAFVVYDCIEGSFIEQWNLIKKHQQVHKLLQKNKSDFMQWEQWEITAKLSLTSRVCDLSLSKLPTESLLLFAILRDNSVQILETGLKKIGSTVFERVAEDQMRAPYKLLTSDCTHLNQLLILFDNLGQMYAMQVPTSHYDKNYKMSPLAVPVCLLEYSVITGIDAADVLMLNLSHLEALTEKLTENFSRQTAYVRHFYYSNFLSLKSNICRIQTKQQDFDDLITLHAIAIAFKSLLRPSDLSSQDKGPAENLSMILSEPVGDVDKVLCVLDAKDFTVEPATLQSLQQLIQWVSDLALNILHKLTEDVLKPKFNKRHGYEICRDVIAVSSVRELLVMIRIWGLLNPHCLPIYTKSVDNFDVLPVMFRLLTRLMQNTSEPDDSLLDECSVLSTQVLVPTRHISTPTTLLNSNATSKLFPFVFQTSVESLNLQDVHYEEVLFSHSIKDDVSNLHLGTHVRSLRICSRCGFINNINKMTKTAALKTWYQRWKYCHCGGFWKFVSF
Length734
PositionTail
OrganismGlossina fuscipes fuscipes (Riverine tsetse fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina.
Aromaticity0.10
Grand average of hydropathy-0.046
Instability index43.18
Isoelectric point6.48
Molecular weight83708.79
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09032
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.66|      10|      25|     246|     255|       2
---------------------------------------------------------------------------
  246-  255 (19.48/11.21)	FI..EQWNLIKK
  270-  281 (15.18/ 7.25)	FMqwEQWEITAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.13|      14|      25|     685|     699|       3
---------------------------------------------------------------------------
  685-  699 (22.80/17.87)	LGTHVRSLRICsRCG
  713-  726 (32.34/20.92)	LKTWYQRWKYC.HCG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     164.21|      46|     153|       9|      54|       4
---------------------------------------------------------------------------
    9-   54 (85.11/62.14)	SVCGCKEAVASVLEW.NPTGELLLIGYKHGLAEIWGMKANCMNSWFL
  165-  211 (79.10/57.20)	SYCPTGRFNVAINNWsEPRISCFKIGVEREQDDTLNLKCGAMASIFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.77|      23|      25|     589|     611|       5
---------------------------------------------------------------------------
  566-  583 (25.30/12.17)	.....LLVMIRIWGLLNPHCLPI
  589-  611 (40.13/23.06)	DNFDVLPVMFRLLTRLMQNTSEP
  617-  636 (33.34/18.07)	DECSVLSTQVLVPTR...HISTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.97|      25|     153|     282|     306|       6
---------------------------------------------------------------------------
  282-  306 (39.44/27.58)	LSLTSRVCDLSLSKLPTESLL.LFAI
  436-  461 (37.53/25.86)	LSLKSNICRIQTKQQDFDDLItLHAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     189.32|      57|     269|      74|     133|       7
---------------------------------------------------------------------------
   74-  133 (95.82/79.89)	SKATYFNMQKKDLQNYSDKYERldQRPTLAY...FGCSP..VEGCfLLTASGLMGVFTIPRLPMN
  344-  405 (93.50/66.11)	SDCTHLNQLLILFDNLGQMYAM..QVPTSHYdknYKMSPlaVPVC.LLEYSVITGIDAADVLMLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.84|      21|     123|     406|     426|       8
---------------------------------------------------------------------------
  406-  426 (35.30/24.70)	LSHLEALTEK.LTENFSRQTAY
  530-  551 (33.54/23.10)	LNILHKLTEDvLKPKFNKRHGY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09032 with Med16 domain of Kingdom Metazoa
Unable to open file!