<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09019
| Description |
Uncharacterized protein |
| Sequence | MTSASNINSNLMDEFEEAFQNCLLSLTKLEANTGSTKEEIEFEAQKTIDRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENHDLRIEIQRKEALLNKHYSRLEEWKACLSDIQQNPTTLNRPVGPAVGAVIPGVMSDGMPGTSMGVGAAASLGVIPQRSGMLPNMVGQMPQMASQTSQQHLQNHKILQAQQMQQQLRMMGKLTK |
| Length | 205 |
| Position | Head |
| Organism | Glossina brevipalpis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.420 |
| Instability index | 54.70 |
| Isoelectric point | 6.43 |
| Molecular weight | 22945.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09019
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.14| 16| 21| 124| 141| 1
---------------------------------------------------------------------------
124- 141 (23.52/26.47) VGPAVG.AVIPgVMSdGM.P
147- 164 (22.62/13.97) VGAAASlGVIP.QRS.GMlP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.07| 11| 21| 88| 98| 2
---------------------------------------------------------------------------
88- 98 (17.44/10.07) EIQRKEALLNK
112- 122 (19.63/12.08) DIQQNPTTLNR
---------------------------------------------------------------------------
|