Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MSQVTSSKESLHQALQSRIIPNQEYLLQGSIIESAVDHLLHRLRGLCDNVETSPETFHDLEVCMSMRQQNAQVPINLRVRRALDREMPYQLRYIGHPEIDRSRPTLVRSSLDVGCTSTVLEFLTELGCRLEYEYISQGYMFRKGRMKITVAKIFKIMPGKPHDSEPVCQSYLVELSVVAPNGQDSIGDEMRAFAEQLKPLVQLEKIDYKRLG |
Length | 212 |
Position | Head |
Organism | Glossina brevipalpis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.356 |
Instability index | 58.82 |
Isoelectric point | 6.60 |
Molecular weight | 24280.70 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09017 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.61| 14| 31| 127| 140| 4 --------------------------------------------------------------------------- 127- 140 (27.30/14.89) GCRLEYEYISQGYM 159- 172 (27.31/14.90) GKPHDSEPVCQSYL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KIDYKRL 2) YQLRYI | 205 89 | 211 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab