<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08988
Description |
Uncharacterized protein |
Sequence | MDLKASISNALTSIPATTLVSPRLGGENKEHIIRQYLQKAAAAHNIKHLQVLMSTLAKLTEAHLITAHHRMLCFKLINKLISHVDYTGVREVLKVCHYKGQFFRLNINVSYLPQLLALEDIIKHIFDRKNCLLPAYFIVNEILKPFPYHWKFNKLTTDFVDEFRRTPQTVSIISHAHMFPIVELFGYADHLMNSWKLDPNTLKFILKDNLPYESELFAEQSQLLRYVLEQTCSKEMVPTMLNLQKQQKQR |
Length | 250 |
Position | Tail |
Organism | Glossina austeni (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.122 |
Instability index | 44.94 |
Isoelectric point | 9.26 |
Molecular weight | 29127.80 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08988
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.19| 20| 47| 86| 105| 1
---------------------------------------------------------------------------
86- 105 (38.05/26.54) YTGVREVLKVCHYKGQFFRL
136- 155 (40.14/28.37) YFIVNEILKPFPYHWKFNKL
---------------------------------------------------------------------------
|