<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08983
Description |
Uncharacterized protein |
Sequence | MTSSSNVNSNLMDEFEEAFQNCLLSLTKLEANTGSTKEEIEFEAQKTIDRFIDVARQMEAFFLQKRFLVSTLKPDQLIKDENHDLRIEIQRKEALLNKHYSRLEEWKACLSDIQQNPSNLNRPVVGPVIPGVMGEGMAGASVTGAPMGVGAAAGLAVIPQRSGMLPSMVGQMAQMAGQSSQQHLQNHKILQAQQMQQQLRMMGKLPK |
Length | 207 |
Position | Head |
Organism | Glossina austeni (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.373 |
Instability index | 52.60 |
Isoelectric point | 6.43 |
Molecular weight | 22983.20 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08983
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.47| 11| 17| 146| 161| 1
---------------------------------------------------------------------------
146- 156 (19.93/19.06) PMGVGAAAGLA
166- 176 (21.54/ 7.10) PSMVGQMAQMA
---------------------------------------------------------------------------
|