<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08981
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAKMYGKGGKILAQRGYFKDQAFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKMFNSVNNTQLNAAATCGTEINEAQQPQMAAQQPGSNSAAGVNIQNGNTGVNTQQAQLVGSQQQPQQMNGTNSST |
| Length | 163 |
| Position | Middle |
| Organism | Glossina austeni (Savannah tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.663 |
| Instability index | 45.55 |
| Isoelectric point | 9.02 |
| Molecular weight | 18687.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08981
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.60| 16| 22| 40| 61| 1
---------------------------------------------------------------------------
40- 61 (23.93/26.69) KylmypmCLYFLD...LLQYEHFRR
67- 85 (28.67/15.35) Q......CCKFIDdqaILQWQHYTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.75| 11| 36| 113| 126| 2
---------------------------------------------------------------------------
113- 126 (18.33/14.95) QQPQmaaQQPGSNS
151- 161 (23.42/11.06) QQPQ...QMNGTNS
---------------------------------------------------------------------------
|