<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08977
Description |
Uncharacterized protein |
Sequence | MLNYGLQSVVNICKRNNTLQHPSENPIMIKTKICNLGPLRTAEMIRDGEHDFELRGIFIIKGHEKIKFSLLLRTQTTANRDNSTIKKVQDHFRTTQLLFKRMGLIYERWNHGCLGYLQVESLIPFKDKPEHRKALQENQELINSYNFINLTCVDAHFLSDETMQAFQNRDNE |
Length | 172 |
Position | Head |
Organism | Glossina austeni (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.563 |
Instability index | 26.05 |
Isoelectric point | 8.68 |
Molecular weight | 20177.93 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | DNA binding GO:0003677 IEA:InterPro
DNA-directed 5'-3' RNA polymerase activity GO:0003899 IEA:UniProtKB-KW
|
GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08977
No repeats found
No repeats found
|