<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08976
| Description |
Uncharacterized protein |
| Sequence | MEKLNFTLGAVRNLRSSVRQCFEKLADGSPEQNEENNAKFLLEFQENFSDINHQIKELEGVINSLQVPPAPYYLGNTTYLAQETTQDRQALYSQLVHDHSLLAYNNLNVNSLRRSYIYNSQKRGRVQCSTCNTPDPDEISHPNTTYKVCRPFGSSAVVVITISHVLKAALVCKGVLIEWVSVKGFDEHIDFDDLFAESRYAVFRKVQENTQAAMLHFFSPTLPDLAIKSYMAWFHSYSRLFVEPCKRCGKFLANGLPPTWRDLRTLEPYHEECKN |
| Length | 275 |
| Position | Tail |
| Organism | Glossina austeni (Savannah tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.412 |
| Instability index | 42.50 |
| Isoelectric point | 6.51 |
| Molecular weight | 31566.36 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08976
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.10| 12| 21| 139| 150| 2
---------------------------------------------------------------------------
139- 150 (23.62/14.65) ISHPNTTYKVCR
162- 173 (20.48/11.97) ISHVLKAALVCK
---------------------------------------------------------------------------
|