<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08951
| Description |
Uncharacterized protein |
| Sequence | MWSALLTQHIDGKASIVTYTALLTLQLIQGNLPYEPDLVEEESQLLHYVLEQTYSKKMVCIMLNLQKQRKQRCNTLEKQLASLITNEMTEPTDNAGSDFNAPDEQI |
| Length | 106 |
| Position | Tail |
| Organism | Glossina austeni (Savannah tsetse fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea>
Glossinidae> Glossina.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.357 |
| Instability index | 46.57 |
| Isoelectric point | 4.72 |
| Molecular weight | 12098.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08951
No repeats found
No repeats found
|