Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MELSPNADAVDIKPTLTADGLIKTSPTAPTTTTANTTAGNSGLTVARLDIEILPVIYDILRCVEKDPLDNSTKQRESQECSQKILELQKRFESARNQIKQLPGIDYNKEEQLQKLELLHNQLTLKQQLIRKYKDIQF |
Length | 137 |
Position | Middle |
Organism | Glossina austeni (Savannah tsetse fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Hippoboscoidea> Glossinidae> Glossina. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.582 |
Instability index | 55.36 |
Isoelectric point | 5.87 |
Molecular weight | 15493.50 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP08950 No repeats found |
MoRF Sequence | Start | Stop |
1) QKILELQKRF 2) VEKDPL | 82 63 | 91 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab