<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08949
| Description |
Uncharacterized protein |
| Sequence | MAGSLGGMFSGQPPGPPPPPPGLPGQPSLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDISVQHKKPAEMPQGSLAYLEQASANIPAPLKQT |
| Length | 178 |
| Position | Head |
| Organism | Neotoma lepida (Desert woodrat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Neotominae> Neotoma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.498 |
| Instability index | 66.51 |
| Isoelectric point | 5.39 |
| Molecular weight | 19538.96 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.27| 15| 16| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (24.33/20.91) QKPDQVIKEDVSELR
123- 137 (23.94/20.45) QRKDALVQKHLTKLR
---------------------------------------------------------------------------
|