<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08948
| Description |
Uncharacterized protein |
| Sequence | MAAPQQQASAVSSAAGVSGPGSAGGPGPQQQPPPAPLVGPGQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTTAASTGPGGSL |
| Length | 199 |
| Position | Tail |
| Organism | Neotoma lepida (Desert woodrat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Neotominae> Neotoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.328 |
| Instability index | 61.99 |
| Isoelectric point | 5.86 |
| Molecular weight | 20905.48 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.27| 17| 22| 4| 24| 1
---------------------------------------------------------------------------
4- 24 (26.96/19.49) PQQQasavSSAAGVSGPGSAG
28- 44 (36.31/17.84) PQQQ....PPPAPLVGPGQSG
---------------------------------------------------------------------------
|