<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08945
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MRGARAGREMAAPDSGRWGECGPRPPGRLGARGGQEPGTLLGAVGMMDLAYVCEWEKWTKSTYCPSLPLACACEAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSQVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVAAADGSSASPVKFYKVCVSVVSEKCRIDTEILPSLFMRCTTDPNRKDRFPAITHLKFLARDMSEQVLLCASSQTSSLVECWSLRKEGLPVNNIFQQISPVVGDKQPMXLKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFQDGSVHMVHRLSLQTMAVLYSSAPRSLDEPALKRPRTTGPAVHFKAMQLSWTSLALVGIDNHGKVLSTRILAMKASLCKLSPCTVARVCDYHTKLFLMAITSTLKSLLRPHFLNTPDKSPGDRLAEICAKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVGDFVLYLLVSLPNQVSPEPQPRPLVSLPNQGSPLRPGHSFLRDGTSLGMLRELMVVVRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEGLVDECCLLPSQLLVPNLDWLPASDGLVSRLQPKQPLRLRFGRAPTLPSSTSTLQLDGLSRAPGQPKIDHLRRLHLGAYPTEECKACTRCGCVTMLKSPNKTTAVKQWEQRWIKNCLCGGLWRRVPLSCP |
| Length | 779 |
| Position | Tail |
| Organism | Neotoma lepida (Desert woodrat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea>
Cricetidae> Neotominae> Neotoma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.023 |
| Instability index | 48.89 |
| Isoelectric point | 8.80 |
| Molecular weight | 85039.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP08945
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.88| 10| 15| 551| 560| 1
---------------------------------------------------------------------------
551- 560 (20.67/11.48) LVSLPNQVSP
567- 576 (21.22/11.97) LVSLPNQGSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.14| 18| 18| 334| 351| 3
---------------------------------------------------------------------------
334- 351 (29.60/16.93) LSATN.DLDRVSAVAL.PKL
353- 372 (22.54/11.37) ISLTNtDLKVASDTQFyPGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.75| 29| 300| 126| 158| 6
---------------------------------------------------------------------------
126- 158 (46.79/41.65) LSWlhngVKLAL.HVEKSGA..SS..FGEKFSRVKFSP
427- 460 (38.96/24.08) LSW....TSLALvGIDNHGKvlSTriLAMKASLCKLSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 69.75| 15| 32| 681| 695| 7
---------------------------------------------------------------------------
659- 672 (20.22/ 9.43) .PS.QLL.VPNLDWLPA
681- 695 (28.99/16.93) QPK.QPL.RLRFGRAPT
714- 730 (20.55/ 9.71) QPKiDHLrRLHLGAYPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.11| 13| 301| 298| 310| 8
---------------------------------------------------------------------------
298- 310 (26.16/16.29) VECWSLRKEG.LPV
600- 613 (20.95/11.33) VRIWGLLKPScLPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.05| 10| 18| 70| 81| 9
---------------------------------------------------------------------------
70- 81 (17.83/19.07) ACACEAITCleW
91- 100 (21.22/14.27) ADADGQIKC..W
---------------------------------------------------------------------------
|