<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08935
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDYFAYSPFWDTKSNNSVLRTQRRVENPTYGHAEEKIELNAFKSGFEYIISHAQPPDLFVIQKREVEPSGRRDRVTGCWFVLHEKIYQSPTIYDVVSARLRNASYLISKTLNTLSESHPSSNPRTTTVWRSLPPEAEAEAEAEADTNTNGEAEVANGAEVVPEDIEKPHQKQTFDWNLYHSLQTTRSSLDSLDRLSKTKTSQVNPMEELKNIEAQISSQIGVFSNPSNTNNQHQNQSQPQGRAGSGSGSITTRSVRGMTPMSINLAGLASGMSPSSAGLGQTPNLGGLGVGVPSPRISGLGGIGGGLSPAAFSARAVSIAGNSPAPLSASYTQP |
| Length | 334 |
| Position | Head |
| Organism | Kwoniella dejecticola CBS 10117 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.561 |
| Instability index | 53.27 |
| Isoelectric point | 6.19 |
| Molecular weight | 36048.44 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08935
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.50| 17| 18| 264| 280| 1
---------------------------------------------------------------------------
243- 257 (19.66/ 8.73) ..AGSGSGS.ITTRSVRG
264- 280 (30.89/17.81) NLAGLASGM.SPSSAGLG
284- 301 (26.95/14.62) NLGGLGVGVpSPRISGLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 30.19| 11| 16| 201| 215| 2
---------------------------------------------------------------------------
201- 215 (14.61/18.02) SQV....NPmeelKNIEAQ
218- 232 (15.58/ 7.49) SQIgvfsNP....SNTNNQ
---------------------------------------------------------------------------
|