| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEDLITSLYPPPPPYYKYFTPENLAQYKEWTNSSPDTPLPGELRLQVPPEVPSADQYRGYGSVWSLENKLPSLKDLGWRQLYRDEDETITSKAKIEELHKLLDSLLLNFLELVASVSVEPGKFYVKIEHLKLILINMNHLLNTYRPHQTRESLIMLLQSQIDSKKAEIAEMDLVTRAVKQAIADLVLSEPAGAGGDAPETEPPQETDSVRDSERSRKLEVLQKLMAESPTA |
| Length | 232 |
| Position | Middle |
| Organism | Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Metschnikowia. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.477 |
| Instability index | 54.18 |
| Isoelectric point | 4.93 |
| Molecular weight | 26272.59 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP08923 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) LITSLY 2) PPYYKYFTPENLAQYKEW 3) RKLEVLQKLMAE | 5 14 217 | 10 31 228 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab