<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08901
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MTVKWLMHWQPNPGATLNSQILAEACACAEGLGGAKDGRWRTAMTFYRPMPRDSSAPPADVPRDFLGLALHDRPDTYFFILRAHRLVLHADASIQAIMEKLQSYKARVVFNFEGFQYKLGDFRLRVGKCVPSMAETLRGIMMEVEYLPLSSIEKSRQILEEFFDIWQEALAKKSLPGHFIHIESNFADYGLQDHYTSQHTAVQYATCMAQLMAAVRS |
| Length | 217 |
| Position | Head |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.171 |
| Instability index | 57.14 |
| Isoelectric point | 7.09 |
| Molecular weight | 24677.17 |
| Publications | PubMed=27374615
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08901
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.93| 13| 15| 131| 143| 1
---------------------------------------------------------------------------
131- 143 (24.16/17.90) P.SMAETLRGIMME
148- 161 (17.78/11.60) PlSSIEKSRQILEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.60| 13| 15| 167| 181| 2
---------------------------------------------------------------------------
167- 179 (21.89/19.21) QEALAKKSLPGHF
183- 195 (23.72/12.15) ESNFADYGLQDHY
---------------------------------------------------------------------------
|