<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08900

Description Mediator of RNA polymerase II transcription subunit 25
SequenceMPQNATRTTHSPLPLYIYMYVHTSLSLSLSLTLYIYSSEEERGVEREEGGEEEEERRRRRAMAERQLIVVVEGTAALGPYWSTILSDYLEKIIRSFSANELNGQKISGAGPEFAMVIFNTHGALSAFTVQRSGWTKDPDVFLRWLSGIPFIGGGFNDTATAEGLADALVMFPLPPNPSQQNHEMQKHCILVAASNPYPLPTPVYRPPPPHSENAEAPTESWLADAETTAKSFGQWSISLSVIAPKQLPKLKAIYNAGKRNPRAAEPAVDHAKNPHFLVLLSENFMEARVALTRPPNVSNVKVDGASAAPAASVAPTSSNISVNGSIMSRQALAGGNMPTATVKVEPTTIPSLVPGPTFSHLPAISNVTSQGIPTLQSSSPSPISQEMNAINDNVQEHKPLVNPVSQQLRPVGPAAANVNILNNLSQHRQMMNSTSLAGASSIGLPMHMSSMISSGMTSAAMSGISSLPGVTQNTNLGSFTSATSNMSSNSNIGIAPSLANLQGNISMGQSLSNVAQASLASGGQIGQSGIGMNQNIMSGLGTTGISSGTGPGTMIPTPGMSQQAGVHSLGMTGNSSINMPMTQHPNVQQSQSKYVKIWEGTLSGQRQNQPVFICKLEGYRSASAADTLASDWPSTMQIVRLIAQEHMNNKQYVGKADFLVFRTLNQHGFLGQLQEKKLCAVIQLPTQTLLLSVSDKAGRLIGMLFPGVCC
Length710
PositionUnknown
OrganismAnanas comosus (Pineapple) (Ananas ananas)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae> Bromelioideae> Ananas.
Aromaticity0.05
Grand average of hydropathy-0.173
Instability index51.08
Isoelectric point7.74
Molecular weight75576.99
Publications
PubMed=27374615

Function

Annotated function 
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
DNA binding	GO:0003677	IEA:EnsemblPlants

GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
jasmonic acid mediated signaling pathway	GO:0009867	IEA:EnsemblPlants
positive regulation of defense response	GO:0031349	IEA:EnsemblPlants
positive regulation of flower development	GO:0009911	IEA:EnsemblPlants
positive regulation of transcription, DNA-templated	GO:0045893	IEA:EnsemblPlants
red, far-red light phototransduction	GO:0009585	IEA:EnsemblPlants
response to far red light	GO:0010218	IEA:EnsemblPlants
response to red light	GO:0010114	IEA:EnsemblPlants
trichome branching	GO:0010091	IEA:EnsemblPlants
trichome papilla formation	GO:1905499	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP08900
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.90|      23|      23|     431|     453|       1
---------------------------------------------------------------------------
  359-  384 (24.16/ 7.66)	SHLPAISNVTSQ.GIPT..LQSSSpspIS
  431-  453 (39.99/17.11)	MNSTSLAGASSI.GLPM..HMSSM...IS
  456-  481 (22.74/ 6.81)	MTSAAMSGISSLpGVTQntNLGSF...TS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.85|      36|      81|     223|     266|       2
---------------------------------------------------------------------------
  223-  266 (55.12/42.37)	ADAETTAKSFGQWSISLSVIAPKQLpklkaiynAGKRNPRA...AEP
  308-  346 (56.73/29.29)	APAASVAPTSSNISVNGSIMSRQAL........AGGNMPTAtvkVEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.01|      27|      28|     521|     547|       3
---------------------------------------------------------------------------
  490-  516 (39.23/18.90)	SNIGIAPSLANLQGN..ISMGQSLSNVAQ
  521-  547 (48.29/24.94)	SGGQIGQSGIGMNQN..IMSGLGTTGISS
  551-  576 (38.49/18.41)	PGTMIPTP..GMSQQagVHS.LGMTGNSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.00|      17|     117|     162|     178|       5
---------------------------------------------------------------------------
  162-  178 (32.19/20.38)	EGLADALVMFPLPPNPS
  282-  298 (30.81/19.17)	ENFMEARVALTRPPNVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.47|      14|      28|     386|     400|      12
---------------------------------------------------------------------------
  386-  400 (20.12/17.67)	EMNAINdNVQEHKPL
  417-  430 (24.35/15.63)	NVNILN.NLSQHRQM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08900 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LGTTGISSGTGPGTMIPTPGMSQQAGVHSLGMTGNSSINMPMTQHP
2) SQGIPTLQSSSPSPISQEMNAINDNVQEHKPLVNPVSQQLR
540
369
585
409










Molecular Recognition Features






MoRF SequenceStartStop




1) LYIYM
15
19