<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08890
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MVSSKESMDCPVESPPLPNNPYKDPDDGRQRFLLELEFVQCLANPTYIHCSGISLGFWNPGLGSAETKPSRTVLLRCLRNPLTGSATSLGFRNPWLGYAESSRAVLLRHLHNPLADLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYFFWKNYRNNRLKHILPRPLPEPAAPPVPPPPVPASVPAHPQAPPASLPPMTTAGGSTLSPMQFMGAPSSNLPKADMRNTMGDRRKRKKLEELEHGFLRIPRNSS |
| Length | 286 |
| Position | Middle |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.520 |
| Instability index | 55.02 |
| Isoelectric point | 9.47 |
| Molecular weight | 32460.96 |
| Publications | PubMed=27374615
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08890
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.57| 27| 31| 54| 82| 1
---------------------------------------------------------------------------
54- 82 (50.99/35.80) SLGFWNPGLGSAETkpSRTVLLRCLRNPL
88- 114 (55.57/32.66) SLGFRNPWLGYAES..SRAVLLRHLHNPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.95| 16| 21| 206| 225| 2
---------------------------------------------------------------------------
11- 26 (32.72/ 7.26) PVESPPLPNNPYKDPD
208- 223 (33.23/11.68) PVPPPPVPASVPAHPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.55| 21| 46| 133| 153| 3
---------------------------------------------------------------------------
133- 153 (42.24/23.44) KYLQYWQ..RPEYIKFIMYPHCL
154- 174 (31.36/15.84) FFLELLQ..NANFRNAMAHPGSK
181- 201 (29.94/14.85) QYF.FWKnyRNNRLKHIL.PRPL
---------------------------------------------------------------------------
|