<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08890

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMVSSKESMDCPVESPPLPNNPYKDPDDGRQRFLLELEFVQCLANPTYIHCSGISLGFWNPGLGSAETKPSRTVLLRCLRNPLTGSATSLGFRNPWLGYAESSRAVLLRHLHNPLADLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYFFWKNYRNNRLKHILPRPLPEPAAPPVPPPPVPASVPAHPQAPPASLPPMTTAGGSTLSPMQFMGAPSSNLPKADMRNTMGDRRKRKKLEELEHGFLRIPRNSS
Length286
PositionMiddle
OrganismAnanas comosus (Pineapple) (Ananas ananas)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae> Bromelioideae> Ananas.
Aromaticity0.10
Grand average of hydropathy-0.520
Instability index55.02
Isoelectric point9.47
Molecular weight32460.96
Publications
PubMed=27374615

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP08890
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.57|      27|      31|      54|      82|       1
---------------------------------------------------------------------------
   54-   82 (50.99/35.80)	SLGFWNPGLGSAETkpSRTVLLRCLRNPL
   88-  114 (55.57/32.66)	SLGFRNPWLGYAES..SRAVLLRHLHNPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.95|      16|      21|     206|     225|       2
---------------------------------------------------------------------------
   11-   26 (32.72/ 7.26)	PVESPPLPNNPYKDPD
  208-  223 (33.23/11.68)	PVPPPPVPASVPAHPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.55|      21|      46|     133|     153|       3
---------------------------------------------------------------------------
  133-  153 (42.24/23.44)	KYLQYWQ..RPEYIKFIMYPHCL
  154-  174 (31.36/15.84)	FFLELLQ..NANFRNAMAHPGSK
  181-  201 (29.94/14.85)	QYF.FWKnyRNNRLKHIL.PRPL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08890 with Med31 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RPLPEPAAPPVPPPPVPASVPAHPQAPPASLPPMTTAGGSTLSPMQFMGAPSSNLPKADMRNTMGDRRKRKKLEELEHGFLRIPRNSS
199
286










Molecular Recognition Features






MoRF SequenceStartStop




1) KLEELEHGFLRIPRN
270
284