| Description | Mediator of RNA polymerase II transcription subunit 21 (Fragment) |
| Sequence | MDIISQLQEQVNTIAMLALNTFGTLRRDAPPVRLSPDYPEPPATNPSEETVNVAEQSKAMSAALVQAAKKFDMLVVALPLSGENAQLKRIVNTRKIVATIVATI |
| Length | 104 |
| Position | Middle |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae> Bromelioideae> Ananas. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | 0.054 |
| Instability index | 57.40 |
| Isoelectric point | 6.20 |
| Molecular weight | 11242.93 |
| Publications | PubMed=27374615 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP08889 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) KAMSAALVQAAK 2) PVRLSPDYPEP 3) TFGTLRRDA | 58 31 21 | 69 41 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab