<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08886
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MPSLLLLLPPPLPPPSPPPPPPPPPPLLFSPSSPPPRAQSLLLHLSSLASKLFDASPNRPFWLASYRGSFPAFPPSSSSSSTASPTPISLPSSTKELLALATSLQTHLFESVAELQEILDLQDSAAKLARDVRAKDATLLALAHKTRDAHQVLDQLLDDYADYRRRPLKKARADAGAAPEPEFALRSGLDLQEILAYAHRISYTTFAPPEHGAGLAPLRGALPPAPQDNEMRASQLYHFADLDVGVPKKPTEAKDRAAAAAAAAEPMEALMEPTPPREELPTPPPGVAIPPPLLPIAVPPGWRKGMPVELPSEIPPVPPGWKPGDPITLPLDGVAVGNKAEEPRVSGAPVPAGPPKGPEPIQVKYVQLDINPDQDEYSSDYSSEVGSSEEDDD |
| Length | 393 |
| Position | Middle |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.359 |
| Instability index | 74.11 |
| Isoelectric point | 4.91 |
| Molecular weight | 41805.98 |
| Publications | PubMed=27374615
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 136.54| 33| 33| 295| 327| 1
---------------------------------------------------------------------------
9- 34 (39.70/ 8.03) ........PPPLP...PPSPPP....PPPPPPPllfsPSSP
265- 298 (42.86/ 9.33) EPMEALMEPTP.PREELPTPPPgvaiPPP......llPIAV
299- 331 (53.97/13.91) PPGWRKGMPVELPSEIPPVPPG....WKPGDPI..tlPL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 127.53| 33| 33| 157| 189| 2
---------------------------------------------------------------------------
115- 150 (35.83/15.05) LQEILDLQDS.......A......AKLAR.DVRAKDATLLALahktRDAH
157- 189 (55.43/28.34) LDDYADYRRR.......P......LKKARADAGAAPEPEFAL....RSGL
191- 236 (36.27/15.35) LQEILAYAHRisyttfaPpehgagLAPLRGALPPAPQDNEMR....ASQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.48| 14| 15| 75| 88| 3
---------------------------------------------------------------------------
75- 88 (25.38/11.10) PSSSSSSTASPTPI
91- 104 (20.10/ 7.36) PSSTKELLALATSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.03| 10| 15| 334| 343| 4
---------------------------------------------------------------------------
334- 343 (17.69/ 8.02) VAVG.NKAEEP
350- 360 (16.34/ 6.79) VPAGpPKGPEP
---------------------------------------------------------------------------
|