<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08886

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMPSLLLLLPPPLPPPSPPPPPPPPPPLLFSPSSPPPRAQSLLLHLSSLASKLFDASPNRPFWLASYRGSFPAFPPSSSSSSTASPTPISLPSSTKELLALATSLQTHLFESVAELQEILDLQDSAAKLARDVRAKDATLLALAHKTRDAHQVLDQLLDDYADYRRRPLKKARADAGAAPEPEFALRSGLDLQEILAYAHRISYTTFAPPEHGAGLAPLRGALPPAPQDNEMRASQLYHFADLDVGVPKKPTEAKDRAAAAAAAAEPMEALMEPTPPREELPTPPPGVAIPPPLLPIAVPPGWRKGMPVELPSEIPPVPPGWKPGDPITLPLDGVAVGNKAEEPRVSGAPVPAGPPKGPEPIQVKYVQLDINPDQDEYSSDYSSEVGSSEEDDD
Length393
PositionMiddle
OrganismAnanas comosus (Pineapple) (Ananas ananas)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae> Bromelioideae> Ananas.
Aromaticity0.05
Grand average of hydropathy-0.359
Instability index74.11
Isoelectric point4.91
Molecular weight41805.98
Publications
PubMed=27374615

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP08886
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     136.54|      33|      33|     295|     327|       1
---------------------------------------------------------------------------
    9-   34 (39.70/ 8.03)	........PPPLP...PPSPPP....PPPPPPPllfsPSSP
  265-  298 (42.86/ 9.33)	EPMEALMEPTP.PREELPTPPPgvaiPPP......llPIAV
  299-  331 (53.97/13.91)	PPGWRKGMPVELPSEIPPVPPG....WKPGDPI..tlPL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.53|      33|      33|     157|     189|       2
---------------------------------------------------------------------------
  115-  150 (35.83/15.05)	LQEILDLQDS.......A......AKLAR.DVRAKDATLLALahktRDAH
  157-  189 (55.43/28.34)	LDDYADYRRR.......P......LKKARADAGAAPEPEFAL....RSGL
  191-  236 (36.27/15.35)	LQEILAYAHRisyttfaPpehgagLAPLRGALPPAPQDNEMR....ASQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.48|      14|      15|      75|      88|       3
---------------------------------------------------------------------------
   75-   88 (25.38/11.10)	PSSSSSSTASPTPI
   91-  104 (20.10/ 7.36)	PSSTKELLALATSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.03|      10|      15|     334|     343|       4
---------------------------------------------------------------------------
  334-  343 (17.69/ 8.02)	VAVG.NKAEEP
  350-  360 (16.34/ 6.79)	VPAGpPKGPEP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP08886 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KGMPVELPSEIPPVPPGWKPGDPITLPLDGVAVGNKAEEPRVSGAPVPAGPPKGPEPIQVKYVQLDINPDQDEYSSDYSSEVGSSEEDDD
2) PKKPTEAKDRAAAAAAAAEPMEALMEPTPPREELPTPPPGVAIPPPLLPI
304
247
393
296










Molecular Recognition Features






MoRF SequenceStartStop




1) EPIQVKYVQLDINP
359
372