<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08878
Description |
Putative mediator of RNA polymerase II transcription subunit 26b |
Sequence | MAAAAAVPAPMLLADSNAADADIFQVIEKAIAVAAADSPDELRARRARIAEALYVCLACICSTHRLHNHHHNQEEADQKEEEQEEDCRVGSNLSYDEAEALTEKIEEESHTLGEVLRIKGILSTGREQSYGVLFESLRRLQLMELSVQTLQNVRLERWEGIGDSTSCSRGIGMSTTARTTRCAAMRRGGTEGTAQATLSSALSDSAKP |
Length | 208 |
Position | Unknown |
Organism | Ananas comosus (Pineapple) (Ananas ananas) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.367 |
Instability index | 63.40 |
Isoelectric point | 5.04 |
Molecular weight | 22600.02 |
Publications | PubMed=27374615
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.84| 11| 15| 169| 180| 1
---------------------------------------------------------------------------
169- 180 (16.40/15.74) RGiGMSTTARTT
187- 197 (20.43/13.73) RG.GTEGTAQAT
---------------------------------------------------------------------------
|