<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08877
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MDPEGKKFGRGPRELTGAVDLISHYKLLAHHDFFCKRSLPVSISDTHYLHNVVGDTEIRKGEGMELDQLFQNTPYLRETAARIQQFDLDTLGQALQLRETAPIDLPSAEKGVPTVASKSRSDSKDKERKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKSGHHDSGGDHSKKHHEKKRKHESNEDSAEIHKHKRSKSLSRAVED |
| Length | 211 |
| Position | Head |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.518 |
| Instability index | 47.52 |
| Isoelectric point | 9.49 |
| Molecular weight | 24374.98 |
| Publications | PubMed=27374615
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.21| 21| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 153 (41.34/13.85) HKDKDKEKDKEHKKHKHRHKD
155- 175 (34.87/10.60) SKDKDKEKKKDKSGHHDSGGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.82| 16| 20| 64| 80| 2
---------------------------------------------------------------------------
64- 80 (24.85/19.90) MELDQLFQNTPyLRETA
86- 101 (26.98/15.89) FDLDTLGQALQ.LRETA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.73| 13| 16| 180| 192| 3
---------------------------------------------------------------------------
180- 192 (24.41/10.87) HHEKKRKHESN..ED
197- 211 (18.32/ 6.48) HKHKRSKSLSRavED
---------------------------------------------------------------------------
|