<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08873
| Description |
Cyclin-C1-1 |
| Sequence | MAANFWTSSHCKQLLDPDEVDVVHPLDRERGITQDEFRLVKIHMSFYIWKLAQQVKVRQRVIATATTYFRRVYTRKSMTEYDPRLVTPTCLYLASKAEESTVQARLLVFYIKKMWPDERYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDANITDLTQCAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTAWFEELRADMNVVKNISIEILDFYDTYKIDPQKGLLDEKINPIMNKLPSKA |
| Length | 256 |
| Position | Kinase |
| Organism | Ananas comosus (Pineapple) (Ananas ananas) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.173 |
| Instability index | 39.15 |
| Isoelectric point | 6.13 |
| Molecular weight | 30290.00 |
| Publications | PubMed=27374615
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08873
No repeats found
|