Description | Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
Sequence | MLRLHVLAKWCQQVPLVHYCQQLAATLSSHDTCFTQTADSLFYMHEGLQQARAPLFDVPSAVEVLLTNGYQRLPKCIEDLGMQSTLSADEQKPALKKLDTLVRSKLLEAVIPKEVSEVTISDGIATLRVDGEFKVLLTLGYRGHLTLWRILHLSCLQVQVLRQGRWKDAIRFELISDGHAGGNTAILQLGQDGELESTGLRTPGLKITYWLDLDKNNSDSSPFIKIEPGQDMQIKCLHSSFVLDPLTDKEANFSLDQSCIDVEKLLLKA |
Length | 269 |
Position | Tail |
Organism | Ananas comosus (Pineapple) (Ananas ananas) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae> Bromelioideae> Ananas. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.086 |
Instability index | 43.64 |
Isoelectric point | 5.75 |
Molecular weight | 30069.33 |
Publications | PubMed=27374615 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule plasmodesma GO:0009506 IEA:EnsemblPlants |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule |
GO - Biological Process | cold acclimation GO:0009631 IEA:EnsemblPlants positive regulation of cell population proliferation GO:0008284 IEA:EnsemblPlants regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro systemic acquired resistance GO:0009627 IEA:EnsemblPlants |
Binary Interactions |
Repeats | >MDP08871 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.65| 31| 59| 115| 148| 1 --------------------------------------------------------------------------- 115- 148 (49.35/39.96) VSEVTISDGIATLRV..DGEfkvLLTLGYR..G.HLTLW 175- 210 (42.30/26.29) ISDGHAGGNTAILQLgqDGE...LESTGLRtpGlKITYW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FIKIE 2) TGLRTPGLKITYWLDLD | 223 198 | 227 214 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab