<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08863
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MAGRSRKEAAAEGQRHLEETIAAAFQILSSMNDELCNPALWSSSSSSSSAAAGAAAHPPPTGAGGGGVDSSDSSSHISDGGAAAASAASGGGSGGALDDARHRYKSAVCRATRLHRRHFRFYSGGEHIGTKKQIKQKSRGSKSEIEIKNRHLKLLIDQLRNLIADISMWQSPCSV |
Length | 175 |
Position | Head |
Organism | Ananas comosus (Pineapple) (Ananas ananas) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.501 |
Instability index | 63.02 |
Isoelectric point | 9.51 |
Molecular weight | 18255.05 |
Publications | PubMed=27374615
|
Function
Annotated function |
ECO:0000256 PIRNR:PIRNR013286
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08863
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.97| 24| 25| 43| 67| 1
---------------------------------------------------------------------------
43- 67 (42.56/17.97) SSSSSS..SaAAGAAAHPPPTGAGGGG
70- 95 (39.42/13.52) SSDSSShiS.DGGAAAASAASGGGSGG
---------------------------------------------------------------------------
|