<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08858
Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | DYEHDPASAPDPPPPIQGAFPLFGATYTTDVVLPTLEDQGVRQLYPKGPNIDIKKELRSLNRELQLHILELADILVERPSQYARKVEDISLIFKNMHHLLNSLRPHQARAALVHILERQIQRRKQAVEDIKKREEARRLLKESLQIVDGQLR |
Length | 152 |
Position | Middle |
Organism | Ananas comosus (Pineapple) (Ananas ananas) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Bromeliaceae>
Bromelioideae> Ananas.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.578 |
Instability index | 64.90 |
Isoelectric point | 8.20 |
Molecular weight | 17545.95 |
Publications | PubMed=27374615
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP08858
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.96| 31| 38| 53| 89| 1
---------------------------------------------------------------------------
66- 104 (37.35/37.32) LHILELAdilVERPSQyarKVEDIslIFKNMHHLLNS.LR
113- 145 (42.61/25.38) VHILERQ...IQRRKQ...AVEDI.kKREEARRLLKEsLQ
---------------------------------------------------------------------------
|