<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08847
| Description |
Serine/threonine-protein kinase SSN3 |
| Sequence | MNMTEYKQKRDSCRQKIASKYDILGFISSGTYGRVYKAKSKLKDDNKEYAIKKFKPDKEGEAATYIGISQSACREIALCRELHHENIVGLEEVLLEDKSIHMVFEYAEHDLLQIIGFHSHPERKFMSEYTIKSFLWQLLNGVAYLHANWVMHRDLKPANILVTANGVVKVGDLGLARLFYKPLQPLFNGDKVVVTIWYRAPELLLGSRHYTKAIDIWAIGCIFAELITLRPIFKGEEAKVENKKTVPFQKNQLQKIFDILGNPTKERWPTIDQQPEYPNLSSFRQTPNVLRSLYQQWPIKSEQGCNLLAAMLEYDPLKRITAEEALNHPYFQEDPKPGLDSFAGQPVEFPLRRITNEDKDMRATANVQKTHPVPAVKDDRLTKRPRVDA |
| Length | 389 |
| Position | Kinase |
| Organism | Mortierella elongata AG-77 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mortierellomycotina>
Mortierellomycetes> Mortierellales> Mortierellaceae> Linnemannia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.482 |
| Instability index | 45.32 |
| Isoelectric point | 8.90 |
| Molecular weight | 44847.12 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of filamentous growth GO:0060258 IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay GO:0070481 IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain GO:0070816 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose GO:0000435 IEA:EnsemblFungi
protein destabilization GO:0031648 IEA:EnsemblFungi
response to oxidative stress GO:0006979 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP08847
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.05| 11| 32| 313| 324| 1
---------------------------------------------------------------------------
313- 324 (16.44/14.05) EYdPLKRITAEE
348- 358 (21.61/12.95) EF.PLRRITNED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.32| 17| 17| 171| 187| 2
---------------------------------------------------------------------------
171- 187 (30.04/16.48) GDLGLARLFYKPLQPLF
189- 205 (29.28/15.90) GDKVVVTIWYRAPELLL
---------------------------------------------------------------------------
|