<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08841
Description |
Uncharacterized protein |
Sequence | MAEQEDIAAALEKTQNAIHDVELMINSLNDVRLSVHHVFHILQGRSPPLSGAAFRENAKFTYTALESLAKLAINSEGLLNDAQSTELPKLLGPSPISLETKQKEAQQEDKNAIPTKPLPGVVVATFESEKGPEYANLSVEDTLRWFERKVRKSGTKVRASRLETQQSFPFSTLKVNVSGVMNAFIVLEANKKGRCQSISRLVVFGAGEENSVWEDSSHLVFKKISQIAVGAVDYFMDRTPRSLLGLVLEWISMYSTLFTAPCSGCGKHLYFDSQQFKHLPPTLYTYDEQGMALPFHPACQKK |
Length | 302 |
Position | Tail |
Organism | Mortierella elongata AG-77 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mortierellomycotina>
Mortierellomycetes> Mortierellales> Mortierellaceae> Linnemannia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.263 |
Instability index | 46.73 |
Isoelectric point | 6.72 |
Molecular weight | 33588.97 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP08841
No repeats found
No repeats found
|