<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP08829
| Description |
C/H/G cyclin |
| Sequence | MAANFWTSSHCTHWILDRRRVAEAMKEDLEYVNIDTLTKIKMWYYGIIGKIGKRLQFRQQVVATAIVYFKRFYTKNSMRSTDPSLVAATCIYLACKIEECPQHIKHIIQEMKHALANLGGFDYDTSKVAEFEFYLLEELEFYLIVYHPYRDLTLIAKDLKLEESNLQTAWFVLNDSYRTDVCLFYAPHMIALAALYIICVVHAEQYNDNTNNGGGGGSGHSITNSGSSSNPNTMDDAGILGHNIHLAQLNSSNSAIKTPGAGGGSQNTPTSSSSSSSEGQGINNRNMVQWFADLNVDIEEIIEITQEILSLYSIWKDYEEEQVPAMMQALKMDFDENYELIDPQLEVMQ |
| Length | 349 |
| Position | Kinase |
| Organism | Mortierella elongata AG-77 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mortierellomycotina>
Mortierellomycetes> Mortierellales> Mortierellaceae> Linnemannia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.246 |
| Instability index | 53.77 |
| Isoelectric point | 4.96 |
| Molecular weight | 39525.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP08829
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.27| 13| 20| 209| 222| 1
---------------------------------------------------------------------------
209- 222 (22.12/17.81) NTNNgGGGGSGHSI
232- 244 (23.15/13.37) NTMD.DAGILGHNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.96| 14| 20| 251| 267| 5
---------------------------------------------------------------------------
251- 267 (20.90/22.38) SSNSaikTPGAGGGSQN
273- 286 (25.06/16.95) SSSS...SEGQGINNRN
---------------------------------------------------------------------------
|